PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g077880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ZF-HD
Protein Properties Length: 253aa    MW: 28319.7 Da    PI: 9.0301
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g077880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-3167121358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     k+rY+eC+kNhAas Ggh+vDGCgEfm+s ge+gta++l CaAC+CHR+FHR+e +
  Csa15g077880.1  67 KARYRECQKNHAASSGGHVVDGCGEFMSS-GEDGTAESLLCAACDCHRSFHRKEID 121
                     689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-3955130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.0E-2968120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-3069120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.71570119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.13E-16175249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-28179250IPR009057Homeodomain-like
TIGRFAMsTIGR015657.2E-30188245IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEMVRSKPSV LDHHRLPPYA YPQTADKDKP TTKRNGSDPD PDLDTNPISI APAPRSYARP  60
QTTSPGKARY RECQKNHAAS SGGHVVDGCG EFMSSGEDGT AESLLCAACD CHRSFHRKEI  120
DGLFVVNFNS FGHSQRPLVG RHVSPIMMSF GGGGGGGGPA ESSTEDLNKF HQSFSGNGVD  180
QFHQFQPKKR FRTKFNEEQK DKMMEFAEKI GWRMTKQEDD EVNRFCREIN VKRQVFKVWM  240
HNNKQAAKKK DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-201892461875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010467646.10.0PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-164ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLR0GAP21e-170R0GAP2_9BRAS; Uncharacterized protein
STRINGscaffold_304185.11e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-161homeobox protein 24